PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_28245
Common NameKK1_028504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family G2-like
Protein Properties Length: 369aa    MW: 41231.3 Da    PI: 6.4042
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_28245genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.74e-31252307156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH++Fv+a+++LGGse+AtPk+i+e+m v+gLt+++vkSHLQk+Rl+
  C.cajan_28245 252 KQRRCWSPELHNCFVKALQELGGSEVATPKQIREMMRVDGLTNDEVKSHLQKFRLH 307
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.707249309IPR017930Myb domain
SuperFamilySSF466892.24E-16250310IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-27250310IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-25252307IPR006447Myb domain, plants
PfamPF002495.2E-7254304IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGSVPAELSL DLRPTFVPKT ITDFLCHLST TPNASHKKSL LDDFVHRLEL ELAKIQAFKR  60
ELPLCIFLLN DAISALKGES AKCREQRTEP VLEEFIPLKK RCDQMEEIEK EKECRDKRNW  120
MSSFQLWNSN DNNNNNNNKN AYDCDKRQHY ILENKNDGEE RQPVAKDLFQ YCGNGNGNGN  180
GGSGFVMPFS TYIATKEDKE DCVVNGLSLQ TPGTAVNNTM EGSDSRSISC RVVSSTPSPP  240
PPPPPQLQSA RKQRRCWSPE LHNCFVKALQ ELGGSEVATP KQIREMMRVD GLTNDEVKSH  300
LQKFRLHIRR GPLATGATSV GGLWRQSDFF KGTSSDSPQG PLQLATQSGE GTSRTEGDNL  360
IDDDVKSEL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528384.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A151S4P40.0A0A151S4P4_CAJCA; Two-component response regulator ARR2
STRINGGLYMA07G29490.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-49G2-like family protein